51 Eign GateHereford Herefordshire HR4 0AB
stars - based on reviews 0 5
£££

Mountain Sports specialist retailer since 1986

51 Eign GateHereford Herefordshire HR4 0AB

Your Account

Your Basket

Checkout
  • Connect with us
  • Hassle-free anytime returns policy

    Premium delivery with a 1 hour delivery slot.

    Free Click & Collect

    Earn Rewards Points

    Food & Nutrition

    Food & Nutrition
    Large Image
    Ready to buy Title Short Description Detail Link prices....
      

    Facet Definition Name : Department

    Facet Definition Name : Gender

    Facet Definition Name : Age

    Facet Definition Name : Height

    Facet Definition Name : Body Coverage

    Facet Definition Name : Footwear Weather-proofing

    Facet Definition Name : Hydration Compatible?

    Facet Definition Name : Back System

    Facet Definition Name : Sleeve Length

    Facet Definition Name : Bladder Capacity

    Facet Definition Name : Rucksack Accessories Options

    Facet Definition Name : Person

    Facet Definition Name : Lighting Options

    Facet Definition Name : Navigation Options

    Facet Definition Name : Pole & Axe Options

    Facet Definition Name : Storage Options

    Facet Definition Name : Survival & Emergency Options

    Facet Definition Name : Care Options

    Facet Definition Name : Furniture Type

    Facet Definition Name : B Rating

    Facet Definition Name : C Rating

    Facet Definition Name : Neck Style

    Facet Definition Name : Luggage Options

    Facet Definition Name : Laptop Compatible

    Facet Definition Name : Length Options

    Facet Definition Name : Hat Type

    Facet Definition Name : Stove Fuel Type

    Facet Definition Name : Utensil Type

    Facet Definition Name : Sock Cushioning

    Facet Definition Name : Gate Type

    Facet Definition Name : Protection Type

    Facet Definition Name : Sleeping Mat Size

    Facet Definition Name : Bottle Type

    Facet Definition Name : Bag Length

    Facet Definition Name : Karabiner Shape

    Facet Definition Name : Sock Height

    Facet Definition Name : Tablet Compatible?

    Facet Definition Name : Zip Length

    Facet Definition Name : Baselayer Fit

    Facet Definition Name : Tent Season Rating

    Facet Definition Name : Hood Options

    Facet Definition Name : Sock Weather-Proofing

    • Trek N Eat Chili Vegetable and Hemp Seeds
    • ProductID : 2263
    • £4.35 £5.00 13% off
    • /images/8018813_vegetable-puree-with-chili-and-hemp-seeds.jpg
    • High5 4:1 Energy Bar Cranberry
    • ProductID : 2221
    • £1.30
    • /images/4-1_bar_product.jpg
    • High5 Energy Bar Banana
    • ProductID : 2222
    • £1.20
    • /images/high5energybarbanana.jpg
    • High5 EnergyGel Citrus Blast
    • ProductID : 2224
    • £1.00
    • /images/high-5-energy-gel-citrusblast.jpg
    • High5 EnergyGel Juicy Orange
    • ProductID : 2225
    • £1.00
    • /images/high-5-energy-gel-juicyorange.jpg
    • High5 EnergySource 1.6kg Citrus
    • ProductID : 2229
    • £30.00
    • /images/4-1citrus1.6kgjar.jpg
    • High5 EnergySource Sachet Citrus
    • ProductID : 2230
    • £1.00
    • /images/high52-1summerfruitsachet.jpg
    • High5 EnergySource Sachet Summer Fruits
    • ProductID : 2232
    • £1.00
    • /images/high52-1summerfruitsachet.jpg
    • High5 EnergySource 2.2kg Orange
    • ProductID : 2234
    • £26.00
    • /images/energysourceorange2.2kgjar.jpg
    • High5 Sports Bar Yoghurt Berry
    • ProductID : 2239
    • £1.20
    • /images/sportsbar_product.jpg
    • High5 ProteinSnack Energy Bar
    • ProductID : 32636
    • £1.50 £1.70 12% off
    • /images/goji_top_down_web2-600x600.jpg
    • High5 Zero Active Hydration Neutral
    • ProductID : 32637
    • £6.16 £7.00 12% off
    • /images/1642-zero-neutral.png
    • High5 Zero Active Hydration Berry
    • ProductID : 2241
    • £7.00
    • /images/high5zeroberry.jpg
    • High5 Zero Active Hydration Citrus
    • ProductID : 2242
    • £7.00
    • /images/high5zerocitrus.jpg
    • High5 Zero Active Hydration Pink Grapefruit
    • ProductID : 2243
    • £7.00
    • /images/high5zeropinkgrapefruit.jpg
    • High5 EnergySource Sachet Summer Fruits
    • ProductID : 2228
    • £1.15
    • /images/high54-1summerfruitsachet.jpg
    • High5 EnergySource 2.2kg Citrus
    • ProductID : 2233
    • £26.00
    • /images/high52-1citrus2.2kgtub.jpg
    • High5 EnergySource 2.2kg Summer Fruits
    • ProductID : 2235
    • £26.00
    • /images/high52-1summerfruits2.2kgtub.jpg
    • Wayfayrer Beans and Sausage
    • ProductID : 2212
    • £3.60 £4.00 10% off
    • /images/wayfayrerbeansandsausagesintomatosaucepacked.jpg
    • Wayfayrer Chicken Tikka Masala and Rice
    • ProductID : 2214
    • £3.60 £4.00 10% off
    • /images/wayfayrerchickentikkamassalsaandricepacked.jpg
    • Wayfayrer Chilli Con Carne and Rice
    • ProductID : 2215
    • £3.60 £4.00 10% off
    • /images/wayfayrerchilliconcarneandricepacked.jpg
    • Wayfayrer Lancashire Hot Pot
    • ProductID : 2216
    • £3.60 £4.00 10% off
    • /images/wayfayrerlancashirehotpotpacked.jpg
    • Wayfayrer Beef Bolognese and Pasta Shells
    • ProductID : 2217
    • £3.60 £4.00 10% off
    • /images/wayfayrerpastashellsandbeefbolognesepacked.jpg
    • Wayfayrer Sticky Toffee Pudding
    • ProductID : 2219
    • £4.05 £4.50 10% off
    • /images/wayfayrerstickytoffeepuddingpacked.jpg
    • High5 Sports Bar Caramel
    • ProductID : 2240
    • £1.20
    • /images/high5sportsbarcaramel.jpg
    • Trek N Eat Balkan Rissotto
    • ProductID : 2256
    • £5.66 £6.50 13% off
    • /images/balkan risotto.jpg
    • Trek N Eat Beef Casserole with Noodles
    • ProductID : 2257
    • £5.22 £6.00 13% off
    • /images/beef casserole with noodles.jpg
    • Trek N Eat Beef Stroganoff with Rice
    • ProductID : 2258
    • £5.22 £6.00 13% off
    • /images/beef stroganoff with rice.jpg
    • Trek N Eat Chana Masala
    • ProductID : 2259
    • £4.79 £5.50 13% off
    • /images/chana masala.jpg
    • Trek N Eat Chicken in Curried Rice
    • ProductID : 2261
    • £5.66 £6.50 13% off
    • /images/chicken in currried rice.jpg
    • Trek N Eat Chili Con Carne
    • ProductID : 2262
    • £5.66 £6.50 13% off
    • /images/chilli con carne.jpg
    • Trek N Eat Creamy Pasta with Chicken and Spinach
    • ProductID : 2264
    • £4.79 £5.50 13% off
    • /images/creamy pasta with chicken and spinach.jpg
    • Trek N Eat Garden Vegtables and Soy Risotto
    • ProductID : 2265
    • £4.35 £5.00 13% off
    • /images/garden vegetable risotto.jpg
    • Trek N Eat Mediterranean Fish Stew
    • ProductID : 2267
    • £5.66 £6.50 13% off
    • /images/mediterranean fish stew.jpg
    • Trek N Eat Mushroom Soya Ragout with Pasta
    • ProductID : 2268
    • £4.79 £5.50 13% off
    • /images/mushroom and soya ragout.jpg
    • Trek N Eat Pasta in Soya Bolognese
    • ProductID : 2269
    • £4.79 £5.50 13% off
    • /images/noodles with soya bolognese.jpg
    • Trek N Eat Pasta Primavera
    • ProductID : 2270
    • £4.79 £5.50 13% off
    • /images/pasta primavera.jpg
    • Trek N Eat Salmon Pesto Pasta
    • ProductID : 2271
    • £5.22 £6.00 13% off
    • /images/salmon pesto.jpg
    • Trek N Eat Scrambled Eggs with Onions
    • ProductID : 2272
    • £3.48 £4.00 13% off
    • /images/scrambled eggs with onions.jpg
    • Trek N Eat Spicy Beef Casserole with Noodles
    • ProductID : 2273
    • £5.22 £6.00 13% off
    • /images/spicy beef casserole with noodles.jpg
    • Trek N Eat Swiss Muesli with Milk
    • ProductID : 2275
    • £3.48 £4.00 13% off
    • /images/swiss muesli with milk.jpg
    • Trek N Eat Vanilla Rice Pudding
    • ProductID : 2276
    • £3.48 £4.00 13% off
    • /images/vanilla rice pudding.jpg
    • Trek N Eat Wholegrain Fruit Muesli Milk
    • ProductID : 2277
    • £3.92 £4.50 13% off
    • /images/wholegrain fruit muesli with milk.jpg
    • Wayfayrer All Day Breakfast
    • ProductID : 3193
    • £3.60 £4.00 10% off
    • /images/wayfayreralldaybreakfastpacked.jpg
    • Honey Stinger Dark Chocolate Mint Almond 10g Whey Protein Bar
    • ProductID : 12797
    • £2.25
    • /images/mintalmondpro.jpg
    • High5 Energy Bar Berry
    • ProductID : 2223
    • £1.20
    • /images/high5energybarberry.jpg
    • High5 IsoGel Sports Gel Orange
    • ProductID : 2237
    • £1.00
    • /images/high5isogelsachetorange.jpg
    • High5 Protein Bar Double Chocolate
    • ProductID : 2238
    • £1.70
    • /images/high5proteinbardblchoc.jpg
    • Honey Stinger Waffle Honey
    • ProductID : 12776
    • £1.40
    • /images/hs_hwaffle_packaging.png
    • Honey Stinger Waffle Strawberry
    • ProductID : 12779
    • £1.40
    • /images/hs_swaffle_packaging.jpg
    • Honey Stinger Organic Engergy Chews Pomegranate
    • ProductID : 12783
    • £2.25
    • /images/ls_ppchew_packaging.jpg
    • Honey Stinger Naturally Caffeinated Chews Limeade
    • ProductID : 12784
    • £2.25
    • /images/chews-limeade-web.jpg
    • Honey Stinger Organic Energy Chews Pink Lemonade
    • ProductID : 12785
    • £1.50 £2.25 33% off
    • /images/chews-pinklemonade-web.jpg
    • Honey Stinger Organic Energy Gel Vanilla
    • ProductID : 12791
    • £1.35
    • /images/organicgel-vanilla-web.jpg
    • Honey Stinger Organic Energy Gel Acia Pomegranate
    • ProductID : 12792
    • £1.35
    • /images/hs_apgel_packaging.jpg
    • Honey Stinger Organic Energy Gel Fruit Smoothie
    • ProductID : 12793
    • £1.35
    • /images/hs_fsgel_packaging.jpg
    • Honey Stinger Peanut Butter and Honey Energy Bar
    • ProductID : 12794
    • £2.25
    • /images/hsenergypeanutandhoney.jpg
    • Honey Stinger Energy Bar Rocket Chocolate
    • ProductID : 12800
    • £2.25
    • /images/hsenergyrocketchocolate1.jpg
    More Colours
    Type To Filter
    Price Filter
    Stock & Sale Options

       

    We placed an order for a gift. We wanted a particular product and Trekkitt came up with the best price and the right size in stock. I was a little bit sceptical as it was such a good price - but I have to say how very impressed I am. An order confirmation came through immediately - followed by emails updating me on dispatch and the expected delivery slot (1 hr slot via DPD) and the product was safely delivered within 24hrs of the order being placed. My dad is super impressed with the gift and even though we have no reason to return the product - I would feel very certain that this aspect of customer service will be of the same high standard. I have absolutely no hesitation is recommending Trekkitt - and will actively look to place any future purchases through them. It is great to see a company which values service and delivers on their promises.

    TwinMum, Devon  •   29th Sep.

    Read More Reviews

    Secure Payments from Visa, Mastercard, Maestro & PayPal
    Zesty Framework, Site Design & Integrated Ecommerce ©
    Citrus-Lime Limited